EIF2AK1 antibody (70R-3425)

Rabbit polyclonal EIF2AK1 antibody raised against the N terminal of EIF2AK1

Synonyms Polyclonal EIF2AK1 antibody, Anti-EIF2AK1 antibody, EIFAK1-2 antibody, KIAA1369 antibody, EIFAK1 2, EIFAK1-2, EIF2AK1, HRI antibody, EIFAK1 2 antibody, Eukaryotic Translation Initiation Factor 2-Alpha Kinase 1 antibody
Specificity EIF2AK1 antibody was raised against the N terminal of EIF2AK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen EIF2AK1 antibody was raised using the N terminal of EIF2AK1 corresponding to a region with amino acids TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
Assay Information EIF2AK1 Blocking Peptide, catalog no. 33R-9000, is also available for use as a blocking control in assays to test for specificity of this EIF2AK1 antibody


Immunohistochemical staining using EIF2AK1 antibody (70R-3425)

EIF2AK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF2AK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using EIF2AK1 antibody (70R-3425) | EIF2AK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using EIF2AK1 antibody (70R-3425) | EIF2AK1 antibody (70R-3425) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using EIF2AK1 antibody (70R-3425) | EIF2AK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors