EIF3M antibody (70R-1252)

Rabbit polyclonal EIF3M antibody raised against the N terminal of EIF3M

Synonyms Polyclonal EIF3M antibody, Anti-EIF3M antibody, hfl-B5 antibody, B5 antibody, EIFM-3 antibody, EIFM 3 antibody, PCID1 antibody, Eukaryotic Translation Initiation Factor 3 Subunit M antibody, EIFM-3, GA17 antibody, EIF3M, FLJ29030 antibody, EIFM 3
Specificity EIF3M antibody was raised against the N terminal of EIF3M
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen EIF3M antibody was raised using the N terminal of EIF3M corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Assay Information EIF3M Blocking Peptide, catalog no. 33R-6523, is also available for use as a blocking control in assays to test for specificity of this EIF3M antibody


Immunohistochemical staining using EIF3M antibody (70R-1252)

EIF3M antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF3M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using EIF3M antibody (70R-1252) | EIF3M antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using EIF3M antibody (70R-1252) | EIF3M antibody (70R-1252) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors