EIF4A2 antibody (70R-4903)

Rabbit polyclonal EIF4A2 antibody raised against the N terminal of EIF4A2

Synonyms Polyclonal EIF4A2 antibody, Anti-EIF4A2 antibody, EIFA2-4 antibody, EIFA2-4, EIF4A2, EIFA2 4 antibody, Eukaryotic Translation Initiation Factor 4A Isoform 2 antibody, EIFA2 4
Specificity EIF4A2 antibody was raised against the N terminal of EIF4A2
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen EIF4A2 antibody was raised using the N terminal of EIF4A2 corresponding to a region with amino acids MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA
Assay Information EIF4A2 Blocking Peptide, catalog no. 33R-6430, is also available for use as a blocking control in assays to test for specificity of this EIF4A2 antibody


Western Blot analysis using EIF4A2 antibody (70R-4903)

EIF4A2 antibody (70R-4903) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF4A2 antibody (70R-4903) | EIF4A2 antibody (70R-4903) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors