EIF5A2 antibody (70R-3877)

Rabbit polyclonal EIF5A2 antibody raised against the N terminal of EIF5A2

Synonyms Polyclonal EIF5A2 antibody, Anti-EIF5A2 antibody, EIFA2 5 antibody, EIFA2-5 antibody, EIF5A2, eIF5AII antibody, EIFA2-5, EIF-5A2 antibody, Eukaryotic Translation Initiation Factor 5A2 antibody, EIFA2 5
Specificity EIF5A2 antibody was raised against the N terminal of EIF5A2
Cross Reactivity Human
Applications WB
Immunogen EIF5A2 antibody was raised using the N terminal of EIF5A2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK
Assay Information EIF5A2 Blocking Peptide, catalog no. 33R-5619, is also available for use as a blocking control in assays to test for specificity of this EIF5A2 antibody


Western Blot analysis using EIF5A2 antibody (70R-3877)

EIF5A2 antibody (70R-3877) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF5A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EIF5A2 antibody (70R-3877) | EIF5A2 antibody (70R-3877) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors