ELAVL4 antibody (70R-4836)

Rabbit polyclonal ELAVL4 antibody raised against the N terminal of ELAVL4

Synonyms Polyclonal ELAVL4 antibody, Anti-ELAVL4 antibody, Elav antibody, HUD antibody, PNEM antibody
Specificity ELAVL4 antibody was raised against the N terminal of ELAVL4
Cross Reactivity Human
Applications WB
Immunogen ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
Assay Information ELAVL4 Blocking Peptide, catalog no. 33R-6346, is also available for use as a blocking control in assays to test for specificity of this ELAVL4 antibody

Images

Western Blot analysis using ELAVL4 antibody (70R-4836)

ELAVL4 antibody (70R-4836) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELAVL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ELAVL4 antibody (70R-4836) | ELAVL4 antibody (70R-4836) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors