EMP2 antibody (70R-1915)

Rabbit polyclonal EMP2 antibody raised against the middle region of EMP2

Synonyms Polyclonal EMP2 antibody, Anti-EMP2 antibody, EMP 2, EMP 2 antibody, EMP-2 antibody, Epithelial Membrane Protein 2 antibody, EMP2, EMP-2, MGC9056 antibody, XMP antibody
Specificity EMP2 antibody was raised against the middle region of EMP2
Cross Reactivity Human
Applications IHC, WB
Immunogen EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
Assay Information EMP2 Blocking Peptide, catalog no. 33R-4116, is also available for use as a blocking control in assays to test for specificity of this EMP2 antibody


Western Blot analysis using EMP2 antibody (70R-1915)

EMP2 antibody (70R-1915) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EMP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognised as a putative tumor suppressor gene in certain model systems.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EMP2 antibody (70R-1915) | EMP2 antibody (70R-1915) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors