EN1 antibody (70R-3473)

Rabbit polyclonal EN1 antibody raised against the C terminal of EN1

Synonyms Polyclonal EN1 antibody, Anti-EN1 antibody, EN 1, EN-1 antibody, Engrailed Homeobox 1 antibody, EN1, EN-1, EN 1 antibody
Specificity EN1 antibody was raised against the C terminal of EN1
Cross Reactivity Human
Applications WB
Immunogen EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Assay Information EN1 Blocking Peptide, catalog no. 33R-5203, is also available for use as a blocking control in assays to test for specificity of this EN1 antibody


Western Blot analysis using EN1 antibody (70R-3473)

EN1 antibody (70R-3473) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EN1 antibody (70R-3473) | EN1 antibody (70R-3473) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors