ENOX1 antibody (70R-4808)

Rabbit polyclonal ENOX1 antibody raised against the middle region of ENOX1

Synonyms Polyclonal ENOX1 antibody, Anti-ENOX1 antibody, PIG38 antibody, Ecto-Nox Disulfide-Thiol Exchanger 1 antibody, cCNOX antibody, bA64J21.1 antibody, FLJ10094 antibody, CNOX antibody
Specificity ENOX1 antibody was raised against the middle region of ENOX1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE
Assay Information ENOX1 Blocking Peptide, catalog no. 33R-7696, is also available for use as a blocking control in assays to test for specificity of this ENOX1 antibody


Western Blot analysis using ENOX1 antibody (70R-4808)

ENOX1 antibody (70R-4808) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENOX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ENOX1 antibody (70R-4808) | ENOX1 antibody (70R-4808) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors