ENPP6 antibody (70R-5392)

Rabbit polyclonal ENPP6 antibody raised against the middle region of ENPP6

Synonyms Polyclonal ENPP6 antibody, Anti-ENPP6 antibody, MGC33971 antibody, NPP6 antibody, Ectonucleotide Pyrophosphatase/Phosphodiesterase 6 antibody
Specificity ENPP6 antibody was raised against the middle region of ENPP6
Cross Reactivity Human,Mouse
Applications WB
Immunogen ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS
Assay Information ENPP6 Blocking Peptide, catalog no. 33R-2561, is also available for use as a blocking control in assays to test for specificity of this ENPP6 antibody


Western Blot analysis using ENPP6 antibody (70R-5392)

ENPP6 antibody (70R-5392) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ENPP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ENPP6 antibody (70R-5392) | ENPP6 antibody (70R-5392) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors