EPB41 antibody (70R-3845)

Rabbit polyclonal EPB41 antibody

Synonyms Polyclonal EPB41 antibody, Anti-EPB41 antibody, EPB-41, EPB 41, EL1 antibody, HE antibody, Erythrocyte Membrane Protein Band 4.1 antibody, Elliptocytosis 1 antibody, EPB-41 antibody, 4.1R antibody, EPB 41 antibody, EPB41
Cross Reactivity Human
Applications WB
Immunogen EPB41 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK
Assay Information EPB41 Blocking Peptide, catalog no. 33R-7766, is also available for use as a blocking control in assays to test for specificity of this EPB41 antibody


Western Blot analysis using EPB41 antibody (70R-3845)

EPB41 antibody (70R-3845) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPB41 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EPB41 antibody (70R-3845) | EPB41 antibody (70R-3845) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors