EPHX1 antibody (70R-5355)

Rabbit polyclonal EPHX1 antibody

Synonyms Polyclonal EPHX1 antibody, Anti-EPHX1 antibody, EPHX-1, EPHX-1 antibody, EPHX1, EPOX antibody, EPHX 1, MEH antibody, EPHX antibody, EPHX 1 antibody, Epoxide Hydrolase 1 Microsomal antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
Assay Information EPHX1 Blocking Peptide, catalog no. 33R-1773, is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody


Western Blot analysis using EPHX1 antibody (70R-5355)

EPHX1 antibody (70R-5355) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPHX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EPHX1 antibody (70R-5355) | EPHX1 antibody (70R-5355) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors