EPRS antibody (70R-3534)

Rabbit polyclonal EPRS antibody raised against the middle region of EPRS

Synonyms Polyclonal EPRS antibody, Anti-EPRS antibody, PIG32 antibody, Glutamyl-Prolyl-tRNA Synthetase antibody, EARS antibody, QPRS antibody, DKFZp313B047 antibody, QARS antibody, PARS antibody
Specificity EPRS antibody was raised against the middle region of EPRS
Cross Reactivity Human
Applications WB
Immunogen EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL
Assay Information EPRS Blocking Peptide, catalog no. 33R-3367, is also available for use as a blocking control in assays to test for specificity of this EPRS antibody


Western Blot analysis using EPRS antibody (70R-3534)

EPRS antibody (70R-3534) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 170 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPRS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using EPRS antibody (70R-3534) | EPRS antibody (70R-3534) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors