Epsin 2 antibody (70R-2205)

Rabbit polyclonal Epsin 2 antibody raised against the middle region of EPN2

Synonyms Polyclonal Epsin 2 antibody, Anti-Epsin 2 antibody, EHB21 antibody, EPN2 antibody, KIAA1065 antibody
Specificity Epsin 2 antibody was raised against the middle region of EPN2
Cross Reactivity Human
Applications WB
Immunogen Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM
Assay Information Epsin 2 Blocking Peptide, catalog no. 33R-8516, is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody


Western Blot analysis using Epsin 2 antibody (70R-2205)

Epsin 2 antibody (70R-2205) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Epsin 2 antibody (70R-2205) | Epsin 2 antibody (70R-2205) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors