ERAL1 antibody (70R-4863)

Rabbit polyclonal ERAL1 antibody

Synonyms Polyclonal ERAL1 antibody, Anti-ERAL1 antibody, Era G-Protein-Like 1 antibody
Cross Reactivity Human
Applications WB
Immunogen ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM
Assay Information ERAL1 Blocking Peptide, catalog no. 33R-4675, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody


Western Blot analysis using ERAL1 antibody (70R-4863)

ERAL1 antibody (70R-4863) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ERAL protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ERAL1 antibody (70R-4863) | ERAL1 antibody (70R-4863) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors