ESRRA antibody (70R-1924)

Rabbit polyclonal ESRRA antibody raised against the N terminal of ESRRA

Synonyms Polyclonal ESRRA antibody, Anti-ESRRA antibody, ERR1 antibody, ESRL1 antibody, Estrogen-Related Receptor Alpha antibody, NR3B1 antibody, ERRa antibody, ERRalpha antibody
Specificity ESRRA antibody was raised against the N terminal of ESRRA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN
Assay Information ESRRA Blocking Peptide, catalog no. 33R-4336, is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody


Western Blot analysis using ESRRA antibody (70R-1924)

ESRRA antibody (70R-1924) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESRRA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ESRRA antibody (70R-1924) | ESRRA antibody (70R-1924) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors