Estrogen-Related Receptor Gamma antibody (70R-2648)

Rabbit polyclonal Estrogen-Related Receptor Gamma antibody raised against the N terminal of ESRRG

Synonyms Polyclonal Estrogen-Related Receptor Gamma antibody, Anti-Estrogen-Related Receptor Gamma antibody, DKFZp781L1617 antibody, NR3B3 antibody, ERR3 antibody, ESRRG antibody, KIAA0832 antibody, FLJ16023 antibody
Specificity Estrogen-Related Receptor Gamma antibody was raised against the N terminal of ESRRG
Cross Reactivity Human
Applications WB
Immunogen Estrogen-Related Receptor Gamma antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
Assay Information Estrogen-Related Receptor Gamma Blocking Peptide, catalog no. 33R-9206, is also available for use as a blocking control in assays to test for specificity of this Estrogen-Related Receptor Gamma antibody

Images

Western blot analysis using Estrogen-Related Receptor Gamma antibody (70R-2648)

Recommended ESRRG Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESRRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Estrogen-Related Receptor Gamma antibody (70R-2648) | Recommended ESRRG Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using Estrogen-Related Receptor Gamma antibody (70R-2648) | Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors