ETFA antibody (70R-2504)

Rabbit polyclonal ETFA antibody

Synonyms Polyclonal ETFA antibody, Anti-ETFA antibody, Glutaric Aciduria Ii antibody, MADD antibody, GA2 antibody, EMA antibody, Electron-Transfer-Flavoprotein Alpha Polypeptide antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
Assay Information ETFA Blocking Peptide, catalog no. 33R-9895, is also available for use as a blocking control in assays to test for specificity of this ETFA antibody


Western Blot analysis using ETFA antibody (70R-2504)

ETFA antibody (70R-2504) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ETFA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ETFA antibody (70R-2504) | ETFA antibody (70R-2504) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors