EVI1 antibody (70R-4757)

Rabbit polyclonal EVI1 antibody raised against the middle region of EVI1

Synonyms Polyclonal EVI1 antibody, Anti-EVI1 antibody, EVI 1, MDS1-EVI1 antibody, EVI-1, EVI 1 antibody, AML1-EVI-1 antibody, MGC163392 antibody, EVI-1 antibody, EVI1, PRDM3 antibody, Ecotropic Viral Integration Site 1 antibody, EVI-1 antibody
Specificity EVI1 antibody was raised against the middle region of EVI1
Cross Reactivity Human
Applications WB
Immunogen EVI1 antibody was raised using the middle region of EVI1 corresponding to a region with amino acids KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
Assay Information EVI1 Blocking Peptide, catalog no. 33R-4417, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody


Western blot analysis using EVI1 antibody (70R-4757)

Recommended EVI1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 118 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EVI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using EVI1 antibody (70R-4757) | Recommended EVI1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors