EXOSC3 antibody (70R-1346)

Rabbit polyclonal EXOSC3 antibody raised against the C terminal of EXOSC3

Synonyms Polyclonal EXOSC3 antibody, Anti-EXOSC3 antibody, EXOSC 3 antibody, EXOSC 3, EXOSC-3, EXOSC3, Exosome Component 3 antibody, EXOSC-3 antibody
Specificity EXOSC3 antibody was raised against the C terminal of EXOSC3
Cross Reactivity Human
Applications IHC, WB
Immunogen EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Assay Information EXOSC3 Blocking Peptide, catalog no. 33R-7189, is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody


Immunohistochemical staining using EXOSC3 antibody (70R-1346)

EXOSC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXOSC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using EXOSC3 antibody (70R-1346) | EXOSC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using EXOSC3 antibody (70R-1346) | EXOSC3 antibody (70R-1346) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors