EXPH5 antibody (70R-3864)

Rabbit polyclonal EXPH5 antibody raised against the middle region of EXPH5

Synonyms Polyclonal EXPH5 antibody, Anti-EXPH5 antibody, MGC133291 antibody, Exophilin 5 antibody, SLAC2-B antibody, DKFZp781H0795 antibody, MGC134967 antibody, KIAA0624 antibody
Specificity EXPH5 antibody was raised against the middle region of EXPH5
Cross Reactivity Human
Applications WB
Immunogen EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL
Assay Information EXPH5 Blocking Peptide, catalog no. 33R-7572, is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody

Images

Western Blot analysis using EXPH5 antibody (70R-3864)

EXPH5 antibody (70R-3864) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 222 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXPH5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EXPH5 antibody (70R-3864) | EXPH5 antibody (70R-3864) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors