FABP1 antibody (70R-3518)

Rabbit polyclonal FABP1 antibody raised against the N terminal of FABP1

Synonyms Polyclonal FABP1 antibody, Anti-FABP1 antibody, L-FABP antibody, Fatty Acid Binding Protein 1 Liver antibody, FABPL antibody
Specificity FABP1 antibody was raised against the N terminal of FABP1
Cross Reactivity Human, Mouse
Applications WB
Immunogen FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF
Assay Information FABP1 Blocking Peptide, catalog no. 33R-6421, is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody


Immunohistochemical staining using FABP1 antibody (70R-3518)

FABP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FABP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FABP1 antibody (70R-3518) | FABP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using FABP1 antibody (70R-3518) | FABP1 antibody (70R-3518) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using FABP1 antibody (70R-3518) | FABP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors