FABP7 antibody (70R-1549)

Rabbit polyclonal FABP7 antibody raised against the N terminal of FABP7

Synonyms Polyclonal FABP7 antibody, Anti-FABP7 antibody, Fatty Acid Binding Protein 7 Brain antibody
Specificity FABP7 antibody was raised against the N terminal of FABP7
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen FABP7 antibody was raised using the N terminal of FABP7 corresponding to a region with amino acids NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF
Assay Information FABP7 Blocking Peptide, catalog no. 33R-6680, is also available for use as a blocking control in assays to test for specificity of this FABP7 antibody


Western Blot analysis using FABP7 antibody (70R-1549)

FABP7 antibody (70R-1549) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FABP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FABP7 antibody (70R-1549) | FABP7 antibody (70R-1549) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors