FAH antibody (70R-2625)

Rabbit polyclonal FAH antibody

Synonyms Polyclonal FAH antibody, Anti-FAH antibody, Fumarylacetoacetate Hydrolase antibody, Fumarylacetoacetase antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT
Assay Information FAH Blocking Peptide, catalog no. 33R-8429, is also available for use as a blocking control in assays to test for specificity of this FAH antibody


Immunohistochemical staining using FAH antibody (70R-2625)

FAH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FAH antibody (70R-2625) | FAH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using FAH antibody (70R-2625) | FAH antibody (70R-2625) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using FAH antibody (70R-2625) | FAH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors