FAM113A antibody (70R-4107)

Rabbit polyclonal FAM113A antibody raised against the C terminal of FAM113A

Synonyms Polyclonal FAM113A antibody, Anti-FAM113A antibody, FLJ22376 antibody, FAM-113 antibody, FAM 113, bA12M19.1 antibody, Family With Sequence Similarity 113 Member A antibody, DKFZp547L054 antibody, FAM113, C20orf81 antibody, FAM-113, FAM 113 antibody
Specificity FAM113A antibody was raised against the C terminal of FAM113A
Cross Reactivity Human
Applications WB
Immunogen FAM113A antibody was raised using the C terminal of FAM113A corresponding to a region with amino acids YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG
Assay Information FAM113A Blocking Peptide, catalog no. 33R-10201, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody

Images

Western Blot analysis using FAM113A antibody (70R-4107)

FAM113A antibody (70R-4107) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM113A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM113A is involved in protein binding and hydrolase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM113A antibody (70R-4107) | FAM113A antibody (70R-4107) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors