FAM121B antibody (70R-1480)

Rabbit polyclonal FAM121B antibody raised against the N terminal Of Fam121B

Synonyms Polyclonal FAM121B antibody, Anti-FAM121B antibody, Family With Sequence Similarity 121B antibody, FAM-121, FAM 121, FAM121, FAM 121 antibody, FAM-121 antibody
Specificity FAM121B antibody was raised against the N terminal Of Fam121B
Cross Reactivity Human
Applications WB
Immunogen FAM121B antibody was raised using the N terminal Of Fam121B corresponding to a region with amino acids PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
Assay Information FAM121B Blocking Peptide, catalog no. 33R-6980, is also available for use as a blocking control in assays to test for specificity of this FAM121B antibody


Western Blot analysis using FAM121B antibody (70R-1480)

FAM121B antibody (70R-1480) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAM121B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM121B belongs to the FAM121 family and the function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM121B antibody (70R-1480) | FAM121B antibody (70R-1480) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors