FAM156A antibody (70R-4887)

Rabbit polyclonal FAM156A antibody raised against the N terminal of FAM156A

Synonyms Polyclonal FAM156A antibody, Anti-FAM156A antibody, FAM 156 antibody, FAM-156 antibody, FAM156, DKFZp686B22211 antibody, FAM 156, PRO0659 antibody, Family With Sequence Similarity 156 Member A antibody, FAM-156
Specificity FAM156A antibody was raised against the N terminal of FAM156A
Cross Reactivity Human
Applications WB
Immunogen FAM156A antibody was raised using the N terminal of FAM156A corresponding to a region with amino acids DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG
Assay Information FAM156A Blocking Peptide, catalog no. 33R-2106, is also available for use as a blocking control in assays to test for specificity of this FAM156A antibody


Western Blot analysis using FAM156A antibody (70R-4887)

FAM156A antibody (70R-4887) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM156A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM156A protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM156A antibody (70R-4887) | FAM156A antibody (70R-4887) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors