FAM160B1 antibody (70R-4079)

Rabbit polyclonal FAM160B1 antibody raised against the N terminal of FAM160B1

Synonyms Polyclonal FAM160B1 antibody, Anti-FAM160B1 antibody, FAM-160, FAM160, RP11-106M7.3 antibody, FAM 160 antibody, DKFZp686D10123 antibody, Family With Sequence Similarity 160 Member B1 antibody, FAM 160, FAM-160 antibody, bA106M7.3 antibody
Specificity FAM160B1 antibody was raised against the N terminal of FAM160B1
Cross Reactivity Human
Applications WB
Immunogen FAM160B1 antibody was raised using the N terminal of FAM160B1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH
Assay Information FAM160B1 Blocking Peptide, catalog no. 33R-3884, is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody


Western Blot analysis using FAM160B1 antibody (70R-4079)

FAM160B1 antibody (70R-4079) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM160B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM160B1 antibody (70R-4079) | FAM160B1 antibody (70R-4079) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors