FAM35A antibody (70R-4078)

Rabbit polyclonal FAM35A antibody raised against the N terminal of FAM35A

Synonyms Polyclonal FAM35A antibody, Anti-FAM35A antibody, bA163M19.1 antibody, FAM 35 antibody, FAM-35 antibody, MGC5560 antibody, FAM 35, FAM35, FAM-35, Family With Sequence Similarity 35 Member A antibody
Specificity FAM35A antibody was raised against the N terminal of FAM35A
Cross Reactivity Human
Applications WB
Immunogen FAM35A antibody was raised using the N terminal of FAM35A corresponding to a region with amino acids PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM
Assay Information FAM35A Blocking Peptide, catalog no. 33R-7020, is also available for use as a blocking control in assays to test for specificity of this FAM35A antibody


Western Blot analysis using FAM35A antibody (70R-4078)

FAM35A antibody (70R-4078) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM35A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM35 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM35A antibody (70R-4078) | FAM35A antibody (70R-4078) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors