FAM45B antibody (70R-3663)

Rabbit polyclonal FAM45B antibody raised against the middle region of FAM45B

Synonyms Polyclonal FAM45B antibody, Anti-FAM45B antibody, FAM 45 antibody, HT011 antibody, FAM-45, Family With Sequence Similarity 45 Member A Pseudogene antibody, FAM 45, FAM45, FAM-45 antibody
Specificity FAM45B antibody was raised against the middle region of FAM45B
Cross Reactivity Human
Applications WB
Immunogen FAM45B antibody was raised using the middle region of FAM45B corresponding to a region with amino acids FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA
Assay Information FAM45B Blocking Peptide, catalog no. 33R-2988, is also available for use as a blocking control in assays to test for specificity of this FAM45B antibody


Western Blot analysis using FAM45B antibody (70R-3663)

FAM45B antibody (70R-3663) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM45B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM45 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM45B antibody (70R-3663) | FAM45B antibody (70R-3663) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors