FAM53C antibody (70R-3662)

Rabbit polyclonal FAM53C antibody raised against the N terminal of FAM53C

Synonyms Polyclonal FAM53C antibody, Anti-FAM53C antibody, FAM-53, FAM 53, FAM-53 antibody, C5orf6 antibody, FAM 53 antibody, Family With Sequence Similarity 53 Member C antibody, FAM53
Specificity FAM53C antibody was raised against the N terminal of FAM53C
Cross Reactivity Human
Applications WB
Immunogen FAM53C antibody was raised using the N terminal of FAM53C corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG
Assay Information FAM53C Blocking Peptide, catalog no. 33R-8648, is also available for use as a blocking control in assays to test for specificity of this FAM53C antibody

Images

Western Blot analysis using FAM53C antibody (70R-3662)

FAM53C antibody (70R-3662) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM53C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM53 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM53C antibody (70R-3662) | FAM53C antibody (70R-3662) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors