FAM54A antibody (70R-3511)

Rabbit polyclonal FAM54A antibody raised against the middle region of FAM54A

Synonyms Polyclonal FAM54A antibody, Anti-FAM54A antibody, DUFD1 antibody, FAM 54, FAM54, FAM 54 antibody, FAM-54 antibody, Family With Sequence Similarity 54 Member A antibody, FAM-54
Specificity FAM54A antibody was raised against the middle region of FAM54A
Cross Reactivity Human
Applications WB
Immunogen FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
Assay Information FAM54A Blocking Peptide, catalog no. 33R-6748, is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody

Images

Western Blot analysis using FAM54A antibody (70R-3511)

FAM54A antibody (70R-3511) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM54A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM54A antibody (70R-3511) | FAM54A antibody (70R-3511) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors