FAM71A antibody (70R-4190)

Rabbit polyclonal FAM71A antibody raised against the C terminal of FAM71A

Synonyms Polyclonal FAM71A antibody, Anti-FAM71A antibody, RP11-338C15.4 antibody, Family With Sequence Similarity 71 Member A antibody, FAM-71 antibody, FAM71, FAM-71, FAM 71 antibody, FLJ32796 antibody, FAM 71
Specificity FAM71A antibody was raised against the C terminal of FAM71A
Cross Reactivity Human
Applications WB
Immunogen FAM71A antibody was raised using the C terminal of FAM71A corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE
Assay Information FAM71A Blocking Peptide, catalog no. 33R-2019, is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody

Images

Western Blot analysis using FAM71A antibody (70R-4190)

FAM71A antibody (70R-4190) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM71A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM71A remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM71A antibody (70R-4190) | FAM71A antibody (70R-4190) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors