FAM78A antibody (70R-4444)

Rabbit polyclonal FAM78A antibody raised against the N terminal of FAM78A

Synonyms Polyclonal FAM78A antibody, Anti-FAM78A antibody, C9orf59 antibody, FLJ00024 antibody, FAM-78, FAM 78, FAM78, FAM-78 antibody, Family With Sequence Similarity 78 Member A antibody, FAM 78 antibody
Specificity FAM78A antibody was raised against the N terminal of FAM78A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM78A antibody was raised using the N terminal of FAM78A corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV
Assay Information FAM78A Blocking Peptide, catalog no. 33R-6279, is also available for use as a blocking control in assays to test for specificity of this FAM78A antibody

Images

Western Blot analysis using FAM78A antibody (70R-4444)

FAM78A antibody (70R-4444) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM78A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM78A has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM78A antibody (70R-4444) | FAM78A antibody (70R-4444) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors