FAM79B antibody (70R-3505)

Rabbit polyclonal FAM79B antibody raised against the N terminal Of Fam79B

Synonyms Polyclonal FAM79B antibody, Anti-FAM79B antibody, FAM 79, FAM-79 antibody, FAM79, FAM 79 antibody, FLJ43694 antibody, FAM-79, Family With Sequence Similarity 79 Member B antibody, FLJ41238 antibody, MGC126601 antibody, MGC126599 antibody
Specificity FAM79B antibody was raised against the N terminal Of Fam79B
Cross Reactivity Human
Applications WB
Immunogen FAM79B antibody was raised using the N terminal Of Fam79B corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH
Assay Information FAM79B Blocking Peptide, catalog no. 33R-2108, is also available for use as a blocking control in assays to test for specificity of this FAM79B antibody

Images

Western Blot analysis using FAM79B antibody (70R-3505)

FAM79B antibody (70R-3505) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM79B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM79 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM79B antibody (70R-3505) | FAM79B antibody (70R-3505) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors