FAM80A antibody (70R-3797)

Rabbit polyclonal FAM80A antibody raised against the middle region of FAM80A

Synonyms Polyclonal FAM80A antibody, Anti-FAM80A antibody, FAM80, FAM 80 antibody, FAM-80, RP11-157D18.1 antibody, Family With Sequence Similarity 80 Member A antibody, MGC47816 antibody, FAM-80 antibody, FAM 80
Specificity FAM80A antibody was raised against the middle region of FAM80A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM80A antibody was raised using the middle region of FAM80A corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV
Assay Information FAM80A Blocking Peptide, catalog no. 33R-2255, is also available for use as a blocking control in assays to test for specificity of this FAM80A antibody

Images

Western Blot analysis using FAM80A antibody (70R-3797)

FAM80A antibody (70R-3797) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM80A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FAM80A is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM80A antibody (70R-3797) | FAM80A antibody (70R-3797) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors