FAM81A antibody (70R-4164)

Rabbit polyclonal FAM81A antibody raised against the N terminal of FAM81A

Synonyms Polyclonal FAM81A antibody, Anti-FAM81A antibody, FAM-81 antibody, FAM 81, FAM81, Family With Sequence Similarity 81 Member A antibody, FAM-81, FAM 81 antibody, MGC26690 antibody
Specificity FAM81A antibody was raised against the N terminal of FAM81A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM81A antibody was raised using the N terminal of FAM81A corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT
Assay Information FAM81A Blocking Peptide, catalog no. 33R-3209, is also available for use as a blocking control in assays to test for specificity of this FAM81A antibody


Western Blot analysis using FAM81A antibody (70R-4164)

FAM81A antibody (70R-4164) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM81A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM81 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM81A antibody (70R-4164) | FAM81A antibody (70R-4164) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors