FAM81B antibody (70R-4168)

Rabbit polyclonal FAM81B antibody raised against the N terminal of FAM81B

Synonyms Polyclonal FAM81B antibody, Anti-FAM81B antibody, Family With Sequence Similarity 81 Member B antibody, FAM 81, FAM-81, FAM81, FAM 81 antibody, FAM-81 antibody, FLJ25333 antibody
Specificity FAM81B antibody was raised against the N terminal of FAM81B
Cross Reactivity Human
Applications WB
Immunogen FAM81B antibody was raised using the N terminal of FAM81B corresponding to a region with amino acids MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS
Assay Information FAM81B Blocking Peptide, catalog no. 33R-6333, is also available for use as a blocking control in assays to test for specificity of this FAM81B antibody

Images

Western Blot analysis using FAM81B antibody (70R-4168)

FAM81B antibody (70R-4168) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM81B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FAM81B is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM81B antibody (70R-4168) | FAM81B antibody (70R-4168) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors