FAM83F antibody (70R-3972)

Rabbit polyclonal FAM83F antibody raised against the N terminal of FAM83F

Synonyms Polyclonal FAM83F antibody, Anti-FAM83F antibody, FAM-83 antibody, Family With Sequence Similarity 83 Member F antibody, FAM-83, FAM 83 antibody, FAM 83, FAM83
Specificity FAM83F antibody was raised against the N terminal of FAM83F
Cross Reactivity Human
Applications WB
Immunogen FAM83F antibody was raised using the N terminal of FAM83F corresponding to a region with amino acids KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV
Assay Information FAM83F Blocking Peptide, catalog no. 33R-4281, is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody


Western Blot analysis using FAM83F antibody (70R-3972)

FAM83F antibody (70R-3972) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM83F antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM83F antibody (70R-3972) | FAM83F antibody (70R-3972) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors