FAM90A1 antibody (70R-4363)

Rabbit polyclonal FAM90A1 antibody raised against the N terminal of FAM90A1

Synonyms Polyclonal FAM90A1 antibody, Anti-FAM90A1 antibody, FAM 90 antibody, FAM90, FAM-90 antibody, Family With Sequence Similarity 90 Member A1 antibody, FAM-90, FLJ10408 antibody, FAM 90
Specificity FAM90A1 antibody was raised against the N terminal of FAM90A1
Cross Reactivity Human
Applications WB
Immunogen FAM90A1 antibody was raised using the N terminal of FAM90A1 corresponding to a region with amino acids PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP
Assay Information FAM90A1 Blocking Peptide, catalog no. 33R-7006, is also available for use as a blocking control in assays to test for specificity of this FAM90A1 antibody


Western Blot analysis using FAM90A1 antibody (70R-4363)

FAM90A1 antibody (70R-4363) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM90A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM90A1 antibody (70R-4363) | FAM90A1 antibody (70R-4363) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors