FANCA antibody (70R-3337)

Rabbit polyclonal FANCA antibody raised against the N terminal of FANCA

Synonyms Polyclonal FANCA antibody, Anti-FANCA antibody, FAH antibody, FA1 antibody, FA-H antibody, MGC75158 antibody, FAA antibody, Fanconi Anemia Complementation Group A antibody, FA antibody, FANCH antibody, FACA antibody
Specificity FANCA antibody was raised against the N terminal of FANCA
Cross Reactivity Human
Applications WB
Immunogen FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
Assay Information FANCA Blocking Peptide, catalog no. 33R-4540, is also available for use as a blocking control in assays to test for specificity of this FANCA antibody


Western Blot analysis using FANCA antibody (70R-3337)

FANCA antibody (70R-3337) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FANCA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FANCA antibody (70R-3337) | FANCA antibody (70R-3337) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors