FAS antibody (70R-3743)

Rabbit polyclonal FAS antibody

Synonyms Polyclonal FAS antibody, Anti-FAS antibody, Fas antibody, FAS1 antibody, CD95 antibody, TNFRSF6 antibody, APO-1 antibody, Tnf Receptor Superfamily 6 antibody, ALPS1A antibody, APT1 antibody, FASTM antibody
Cross Reactivity Human
Applications WB
Immunogen FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Assay Information FAS Blocking Peptide, catalog no. 33R-4455, is also available for use as a blocking control in assays to test for specificity of this FAS antibody


Western Blot analysis using FAS antibody (70R-3743)

FAS antibody (70R-3743) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAS antibody (70R-3743) | FAS antibody (70R-3743) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors