FBXO16 antibody (70R-3782)

Rabbit polyclonal FBXO16 antibody raised against the N terminal of FBXO16

Synonyms Polyclonal FBXO16 antibody, Anti-FBXO16 antibody, FBXO16, MGC125925 antibody, FBXO 16, FBXO-16, MGC125924 antibody, FBXO-16 antibody, FBXO 16 antibody, MGC125923 antibody, FBX16 antibody, F-Box Protein 16 antibody
Specificity FBXO16 antibody was raised against the N terminal of FBXO16
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA
Assay Information FBXO16 Blocking Peptide, catalog no. 33R-1795, is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody


Western Blot analysis using FBXO16 antibody (70R-3782)

FBXO16 antibody (70R-3782) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO16 antibody (70R-3782) | FBXO16 antibody (70R-3782) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors