FBXO24 antibody (70R-2249)

Rabbit polyclonal FBXO24 antibody raised against the middle region of FBXO24

Synonyms Polyclonal FBXO24 antibody, Anti-FBXO24 antibody, DKFZp434I1122 antibody, FBXO 24, FBX24 antibody, FBXO-24 antibody, F-Box Protein 24 antibody, FBXO24, FBXO-24, FBXO 24 antibody
Specificity FBXO24 antibody was raised against the middle region of FBXO24
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY
Assay Information FBXO24 Blocking Peptide, catalog no. 33R-2436, is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody


Western Blot analysis using FBXO24 antibody (70R-2249)

FBXO24 antibody (70R-2249) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO24 antibody (70R-2249) | FBXO24 antibody (70R-2249) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors