FBXW10 antibody (70R-3250)

Rabbit polyclonal FBXW10 antibody raised against the N terminal of FBXW10

Synonyms Polyclonal FBXW10 antibody, Anti-FBXW10 antibody, F-Box And Wd Repeat Domain Containing 10 antibody, FBXW 10, FBXW10, HREP antibody, SM25H2 antibody, FBXW-10 antibody, FBXW 10 antibody, Fbw10 antibody, FBXW-10, SM2SH2 antibody
Specificity FBXW10 antibody was raised against the N terminal of FBXW10
Cross Reactivity Human
Applications WB
Immunogen FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN
Assay Information FBXW10 Blocking Peptide, catalog no. 33R-8670, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody


Western Blot analysis using FBXW10 antibody (70R-3250)

FBXW10 antibody (70R-3250) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXW10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXW10 antibody (70R-3250) | FBXW10 antibody (70R-3250) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors