FCRL1 antibody (70R-1853)

Rabbit polyclonal FCRL1 antibody raised against the N terminal of FCRL1

Synonyms Polyclonal FCRL1 antibody, Anti-FCRL1 antibody, Fc Receptor-Like 1 antibody, FCRL-1, IRTA5 antibody, FCRH1 antibody, IFGP1 antibody, FCRL 1, FCRL 1 antibody, FCRL-1 antibody, FCRL1, RP11-367J7.7 antibody, DKFZp667O1421 antibody
Specificity FCRL1 antibody was raised against the N terminal of FCRL1
Cross Reactivity Human
Applications WB
Immunogen FCRL1 antibody was raised using the N terminal of FCRL1 corresponding to a region with amino acids MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
Assay Information FCRL1 Blocking Peptide, catalog no. 33R-6201, is also available for use as a blocking control in assays to test for specificity of this FCRL1 antibody


Western Blot analysis using FCRL1 antibody (70R-1853)

FCRL1 antibody (70R-1853) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FCRL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FCRL1 antibody (70R-1853) | FCRL1 antibody (70R-1853) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors