FDFT1 antibody (70R-1132)

Rabbit polyclonal FDFT1 antibody raised against the N terminal of FDFT1

Synonyms Polyclonal FDFT1 antibody, Anti-FDFT1 antibody, Farnesyl-Diphosphate Farnesyltransferase 1 antibody, SQS antibody, ERG9 antibody, FDFT-1 antibody, DGPT antibody, SS antibody, FDFT1, FDFT-1, FDFT 1 antibody, FDFT 1
Specificity FDFT1 antibody was raised against the N terminal of FDFT1
Cross Reactivity Human,Mouse
Applications WB
Immunogen FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM
Assay Information FDFT1 Blocking Peptide, catalog no. 33R-3852, is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody

Images

Western Blot analysis using FDFT1 antibody (70R-1132)

FDFT1 antibody (70R-1132) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FDFT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FDFT1 antibody (70R-1132) | FDFT1 antibody (70R-1132) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors