FDXR antibody (70R-2532)

Rabbit polyclonal FDXR antibody raised against the middle region of FDXR

Synonyms Polyclonal FDXR antibody, Anti-FDXR antibody, Ferredoxin Reductase antibody, ADXR antibody
Specificity FDXR antibody was raised against the middle region of FDXR
Cross Reactivity Human
Applications WB
Immunogen FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW
Assay Information FDXR Blocking Peptide, catalog no. 33R-4855, is also available for use as a blocking control in assays to test for specificity of this FDXR antibody

Images

Western Blot analysis using FDXR antibody (70R-2532)

FDXR antibody (70R-2532) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FDXR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FDXR antibody (70R-2532) | FDXR antibody (70R-2532) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors