FERMT1 antibody (70R-2667)

Rabbit polyclonal FERMT1 antibody

Synonyms Polyclonal FERMT1 antibody, Anti-FERMT1 antibody, FLJ23423 antibody, unc112a antibody, Fermitin Family Homolog 1 antibody, FERMT 1 antibody, FERMT-1 antibody, C20orf42 antibody, URP1 antibody, KIND1 antibody, FLJ20116 antibody, FERMT 1, DTGCU2 antibody, FERMT-1, FERMT1
Cross Reactivity Human
Applications WB
Immunogen FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
Assay Information FERMT1 Blocking Peptide, catalog no. 33R-5456, is also available for use as a blocking control in assays to test for specificity of this FERMT1 antibody


Western Blot analysis using FERMT1 antibody (70R-2667)

FERMT1 antibody (70R-2667) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FERMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FERMT1 antibody (70R-2667) | FERMT1 antibody (70R-2667) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors