FGF2 antibody (70R-4603)

Rabbit polyclonal FGF2 antibody

Synonyms Polyclonal FGF2 antibody, Anti-FGF2 antibody, HBGF-2 antibody, FGF-2 antibody, FGF 2, FGF2, Fibroblast Growth Factor 2 antibody, FGF 2 antibody, FGF-2, BFGF antibody, FGFB antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Assay Information FGF2 Blocking Peptide, catalog no. 33R-8018, is also available for use as a blocking control in assays to test for specificity of this FGF2 antibody

Images

Western Blot analysis using FGF2 antibody (70R-4603)

FGF2 antibody (70R-4603) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FGF2 antibody (70R-4603) | FGF2 antibody (70R-4603) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors