Fibrinogen Alpha antibody (70R-1553)

Rabbit polyclonal FGA antibody raised against the N terminal of FGA

Synonyms Polyclonal Fibrinogen Alpha antibody, Anti-Fibrinogen Alpha antibody, Fib2 antibody, FGA antibody
Specificity Fibrinogen Alpha antibody was raised against the N terminal of FGA
Cross Reactivity Human
Applications IHC, WB
Immunogen Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
Assay Information Fibrinogen Alpha Blocking Peptide, catalog no. 33R-6003, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody


Immunohistochemical staining using Fibrinogen Alpha antibody (70R-1553)

Fibrinogen Alpha antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FGA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Fibrinogen Alpha antibody (70R-1553) | Fibrinogen Alpha antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using Fibrinogen Alpha antibody (70R-1553) | Fibrinogen Alpha antibody (70R-1553) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £228.91
Size: 100 ug
View Our Distributors